PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28976.m000158
Common NameRCOM_0366130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 431aa    MW: 47151.6 Da    PI: 9.82
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28976.m000158genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.3e-25191235145
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                    d+epgrCrRtDGKkWRCs++v++++k+CErH++rgr+rsrk++e 
  28976.m000158 191 DPEPGRCRRTDGKKWRCSKDVVPDQKYCERHINRGRHRSRKPVEG 235
                    79****************************************986 PP

2QLQ49.51.3e-17120156137
            QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    ++FT+ Ql++Lk+Q l++Ky++a++ vP +Ll ++++
  28976.m000158 120 GPFTPYQLMELKHQSLIFKYISAGASVPTNLLIPLRN 156
                    59*******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-7120156IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.0E-13121154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.888121156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.655191235IPR014977WRC domain
PfamPF088792.5E-21192234IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MEAKPKLVPD EFRFGNKQER SSAVSDDCYV QKTMLLHRNN TPLLRSNSMV HGDTQQQGLI  60
SNYSSSKPEV TTLTRKDDGF VQRSFKTHTG FPYYRSPSAY ARRIGNVTGN VNRASSGIRG  120
PFTPYQLMEL KHQSLIFKYI SAGASVPTNL LIPLRNKSVY PYGLAPPTAS LLSPYSLGGS  180
NLGLNYANTN DPEPGRCRRT DGKKWRCSKD VVPDQKYCER HINRGRHRSR KPVEGQTDSA  240
AKAGSSNSKV VLPVNTSMAP SVLTNPGATN SLVITQQKFK NLEPERPNSS LDAFLNRYSQ  300
GIRNVHDSGK PQDLMGFSNN VSSTMNLKPD QSALILPNKN IPIQESSQSE IGLVSPDSDI  360
TPTQSARVNQ HSWGGNCCTQ LEYSSNGILQ KETEGFASSS SPKGETKLKN NEDGVLNDDA  420
VGSSSVSSST I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4886169e-35AM488616.1 Vitis vinifera contig VV78X030262.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583489.10.0PREDICTED: growth-regulating factor 2
TrEMBLB9T5Q40.0B9T5Q4_RICCO; Putative uncharacterized protein
STRINGPOPTR_0014s00780.11e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-49growth-regulating factor 2